Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

AV44073

Sigma-Aldrich

Anti-SLC22A16 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-6-Oct, Anti-CT2, Anti-FLIPT2, Anti-OKB1, Anti-Solute carrier family 22 (organic cation transporter), member 16, Anti-dJ261K5.1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

63 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_149116

Numéro d'accès UniProt

Q86VW1

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC22A16(85413)

Description générale

The previously assigned protein identifier Q96RU0 has been merged into Q86VW1. Full details can be found on the UniProt database.

Immunogène

Synthetic peptide directed towards the N terminal region of human SLC22A16

Application

Anti-SLC22A16 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

SLC22A16 (CT2; OAT6) is an organic zwitterion transporter protein that transports l-carnitine, a component of mitochondrial fatty acid beta-oxidation process. The transporter does not accept OCT/OCTN cationic or OAT anionic substrates. CT2 is specifically expressed in luminal membrane of epididymal epithelium and within the Sertoli cells of the testis. Human CT2 reportedly mediates the uptake of polyamines and the anticancer drug bleomycin-A5.

Séquence

Synthetic peptide located within the following region: CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mustapha Aouida et al.
The Journal of biological chemistry, 285(9), 6275-6284 (2009-12-29)
Bleomycin is used in combination with other antineoplastic agents to effectively treat lymphomas, testicular carcinomas, and squamous cell carcinomas of the cervix, head, and neck. However, resistance to bleomycin remains a persistent limitation in exploiting the full therapeutic benefit of
Atsushi Enomoto et al.
The Journal of biological chemistry, 277(39), 36262-36271 (2002-06-29)
l-Carnitine is an essential component of mitochondrial fatty acid beta-oxidation and plays a pivotal role in the maturation of spermatozoa within the male reproductive tract. Epididymal plasma contains the highest levels of l-carnitine found in the human body, and initiation
Yan Wu et al.
Apoptosis : an international journal on programmed cell death, 20(8), 1099-1108 (2015-05-23)
AML (acute myeloid leukemia) cells have a unique reliance on mitochondrial metabolism and fatty acid oxidation (FAO). Thus, blocking FAO is a potential therapeutic strategy to target these malignant cells. In the current study, we assessed plasma membrane carnitine transporters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique