Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV40735

Sigma-Aldrich

Anti-PRPF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-ANT-1, Anti-PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), Anti-TOM

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

104 kDa

Espèces réactives

dog, guinea pig, human, bovine, rabbit, mouse, rat, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PRPF6(24148)

Description générale

PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) (PRPF6) is involved in pre-mRNA spliceosome assembly by acting as a link between small nuclear ribonucleoproteins (snRNP) U5 snRNP and U4/U6 snRNP to form U4/U6-U5 tri-snPNP. Mutation of PRPF6 are linked to impairment of pre-mRNA splicing and autosomal-dominant retinitis pigmentosa.

Spécificité

Anti-PRPF6 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, and canine PRP6 pre-mRNA processing factor 6 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human PRPF6

Application

Anti-PRPF6 (AB2) polyclonal antibody is used to tag PRP6 pre-mRNA processing factor 6 homolog for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of PRP6 pre-mRNA processing factor 6 homolog in spliceosome assembly and autosomal-dominant retinitis pigmentosa.

Actions biochimiques/physiologiques

PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Séquence

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sylvie Bannwarth et al.
Brain : a journal of neurology, 137(Pt 8), 2329-2345 (2014-06-18)
Mitochondrial DNA instability disorders are responsible for a large clinical spectrum, among which amyotrophic lateral sclerosis-like symptoms and frontotemporal dementia are extremely rare. We report a large family with a late-onset phenotype including motor neuron disease, cognitive decline resembling frontotemporal

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique