AV38941
Anti-TARDBP (AB1) antibody produced in rabbit
IgG fraction of antiserum
Synonyme(s) :
Anti-TAR DNA binding protein
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
IgG fraction of antiserum
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
45 kDa
Espèces réactives
bovine, rat, guinea pig, human, dog, horse, mouse
Concentration
0.5 mg - 1 mg/mL
Technique(s)
immunohistochemistry: suitable
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Informations sur le gène
human ... TARDBP(23435)
Catégories apparentées
Description générale
TAR DNA binding protein (TARDBP) is a DNA and RNA binding transcription repressor and regulator of pre-mRNA splicing and translation. TARDBP binds to the regulatory element TAR found in the transcription initiation site of the HIV-1 gene Tat; consequently TARDBP is an active repressor of chromosomally integrated HIV-1 tat. TARDBP also regulates alternative splicing of CFTR and apo-II genes. A defective form of TARDBP is associated with amyotrophic lateral sclerosis (ALS).
Spécificité
Anti-TARDBP (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, chicken, and canine TAR DNA binding protein(s).
Immunogène
Synthetic peptide directed towards the N terminal region of human TARDBP
Application
Anti-TARDBP (AB1) polyclonal antibody is used to tag TAR DNA binding protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of TAR DNA binding protein in the repression of gene expression and regulation of pre-mRNA splicing and translation.
Actions biochimiques/physiologiques
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Séquence
Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Jack L Pinkus et al.
Neuromuscular disorders : NMD, 24(7), 611-616 (2014-05-27)
Previous histopathologic studies of sporadic inclusion body myositis (sIBM) identified sarcoplasmic aggregation and myonuclear depletion of the predominantly nuclear heterogeneous nuclear ribonucleoprotein (hnRNP) TDP-43 in sIBM myofibers. Here, we examined sIBM muscle for abnormalities in two other hnRNPs hnRNPA1 and
Chi-Chen Huang et al.
Journal of cell science, 127(Pt 14), 3024-3038 (2014-05-27)
TDP-43 (also known as TARDBP) is a pathological signature protein of neurodegenerative diseases, with TDP-43 proteinopathies including frontotemporal lobar degeneration (FTLD)-TDP and amyotrophic lateral sclerosis (ALS)-TDP. These TDP-43 proteinopathies are characterized by cytoplasmic insoluble TDP-43-positive aggregates in the diseased cells
Hideaki Tagashira et al.
Biochimica et biophysica acta, 1840(12), 3320-3334 (2014-09-02)
Amyotrophic lateral sclerosis (ALS) is a disease caused by motor neuron degeneration. Recently, a novel SIGMAR1 gene variant (p.E102Q) was discovered in some familial ALS patients. We address mechanisms underlying neurodegeneration caused by the mutation using Neuro2A cells overexpressing σ1R(E102Q)
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique