Accéder au contenu
Merck
Toutes les photos(3)

Documents

AV35123

Sigma-Aldrich

Anti-VDAC2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ23841, Anti-RP11-375G3.1, Anti-Voltage-dependent anion channel 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

32 kDa

Espèces réactives

dog, bovine, guinea pig, rabbit, rat, human, horse, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

XP_001133585

Numéro d'accès UniProt

P45880-5

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... VDAC2(7417)

Description générale

VDAC2 is a voltage-dependant anion channel that forms a pathway for metabolite diffusion across the outer membrane of mitochondria. Studies have reported that VDAC2 interacts with BAK and subsequently regulates mitochondrial apoptosis/cell death.
Rabbit Anti-VDAC2 antibody recognizes chicken, human, mouse, rat, bovine, pig, canine, rabbit, and zebrafish VDAC2.

Immunogène

Synthetic peptide directed towards the N terminal region of human VDAC2

Application

Rabbit Anti-VDAC2 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

Actions biochimiques/physiologiques

VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.

Séquence

Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Michael Lazarou et al.
The Journal of biological chemistry, 285(47), 36876-36883 (2010-09-21)
Bax and Bak are pro-apoptotic factors that are required for cell death by the mitochondrial or intrinsic pathway. Bax is found in an inactive state in the cytosol and upon activation is targeted to the mitochondrial outer membrane where it
Soumya Sinha Roy et al.
EMBO reports, 10(12), 1341-1347 (2009-10-13)
Truncated BID (tBID), a proapoptotic BCL2 family protein, induces BAK/BAX-dependent release of cytochrome c and other mitochondrial intermembrane proteins to the cytosol to induce apoptosis. The voltage-dependent anion channels (VDACs) are the primary gates for solutes across the outer mitochondrial
Mayumi Watanabe et al.
Toxicology, 322, 43-50 (2014-05-08)
Parkin is an E3 ubiquitin ligase involved in the elimination of damaged mitochondria. Ubiquitination of mitochondrial substrates by Parkin results in proteasomal as well as lysosomal degradation of mitochondria, the latter of which is executed by the autophagy machinery and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique