Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV34429

Sigma-Aldrich

Anti-USF1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Upstream transcription factor 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

34 kDa

Espèces réactives

bovine, rat, human, dog, rabbit, horse, mouse, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_009053

Numéro d'accès UniProt

P22415

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... USF1(7391)

Description générale

USF1 is a leucine zipper transcription factor that forms a part of complexes that interact with fatty acid synthase (FAS) insulin response sequence (IRS). Valproic acid (VPA) is known to inhibit adipogenesis by repressing USF1-induced synthesis of fatty acids. Studies have reported that USF1 gene is associated with familial combined hyperlipidemia (FCHL).
Rabbit Anti-USF1 (AB2) antibody recognizes human, mouse, rat, rabbit, canine, chicken, pig, and bovine USF1.

Immunogène

Synthetic peptide directed towards the N terminal region of human USF1

Application

Rabbit Anti-USF1 (AB2) can be used for western blot applications at 1.25 μg/ml.

Actions biochimiques/physiologiques

USF1 encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).

Séquence

Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

D Wang et al.
The Journal of biological chemistry, 270(48), 28716-28722 (1995-12-01)
Fatty acid synthase (FAS) plays a central role in de novo lipogenesis in mammals. The concentration or activity of FAS in liver and adipose tissue changes dramatically when animals are subjected to nutritional and hormonal manipulations. We previously reported that
Päivi Pajukanta et al.
Nature genetics, 36(4), 371-376 (2004-03-03)
Familial combined hyperlipidemia (FCHL), characterized by elevated levels of serum total cholesterol, triglycerides or both, is observed in about 20% of individuals with premature coronary heart disease. We previously identified a locus linked to FCHL on 1q21-q23 in Finnish families
Miki Yuyama et al.
The Biochemical journal, 459(3), 489-503 (2014-02-12)
VPA (valproic acid), a short-chain fatty acid that is a HDAC (histone deacetylase) inhibitor, is known to suppress adipogenesis. In the present study, we identified the molecular mechanism of VPA-mediated suppression of adipogenesis in adipocytes. VPA suppressed the accumulation of

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique