Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV32765

Sigma-Aldrich

Anti-CDX4 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Caudal type homeobox transcription factor 4

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

30 kDa

Espèces réactives

horse, dog, rabbit, pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CDX4(1046)

Description générale

Caudal related homeobox (Cdx) genes are known to modulate axial elongation and patterning in many vertebrate embryos. Cdx4 regulates the ontogenesis of placental labyrinth in mice. Furthermore, Cdx4 is known to dysregulate Hox gene expression which causes acute myeloid leukemia in mouse models.
Rabbit Anti-CDX4 antibody recognizes rat, mouse, bovine, and human CDX4.

Immunogène

Synthetic peptide directed towards the C terminal region of human CDX4

Application

Rabbit Anti-CDX4 (AB1) antibody can be used for western blot applications at a concentration of 2.5 μg/ml.

Actions biochimiques/physiologiques

CDX are homeodomain transcription factors related to the Drosophila caudal gene. The vertebrate CDX have been implicated in the development of the posterior embryo. Several signaling molecules, notably retinoic acid (RA) and members of the Wnt (wingless) and fibroblast growth factor (FGF) families, are also implicated in patterning of the posterior vertebrate embryo. CDX family is the target of Wnt, RA and FGF signaling, suggesting that CDX factors act to convey the activity of these signaling molecules to Hox genes.

Séquence

Synthetic peptide located within the following region: KKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Johan van Nes et al.
Development (Cambridge, England), 133(3), 419-428 (2006-01-07)
Caudal related homeobox (Cdx) genes have so far been shown to be important for embryonic axial elongation and patterning in several vertebrate species. We have generated a targeted mutation of mouse Cdx4, the third member of this family of transcription
Dimple Bansal et al.
Proceedings of the National Academy of Sciences of the United States of America, 103(45), 16924-16929 (2006-10-28)
HOX genes have emerged as critical effectors of leukemogenesis, but the mechanisms that regulate their expression in leukemia are not well understood. Recent data suggest that the caudal homeobox transcription factors CDX1, CDX2, and CDX4, developmental regulators of HOX gene

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique