AV32707

Anti-MyBL1 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-A-MYB, Anti-AMYB, Anti-MGC120059, Anti-MGC120061, Anti-v-Myb myeloblastosis viral oncogene homolog (avian)-like 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 49 kDa
• Espèces réactives: rabbit, mouse, horse, dog, rat, human, guinea pig, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_001073885
• Numéro d'accès UniProt: P10243
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... MYBL1(4603)

Description

Description générale

Rabbit polyclonal anti-MyBL1 antibody reacts with chicken, canine, human, mouse, and rat v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 transcription factors.

v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 (MyBL1) which is expressed predominantly as a tissue-specific transcription factor in spermatocytes and breast epithelial cells is a male-specific regulator of several crucial meiotic processes. MYBL1 is a master regulator of meiotic genes that are involved in multiple processes in spermatocytes, particularly those required for cell cycle progression through pachynema. MYBL1 directs germ cell-specific activation via the CRE site of certain genes.

Immunogène

Synthetic peptide directed towards the middle region of human MYBL1

Application

Rabbit Anti-MyBL1 antibody can be used for IHC (4-8μg/ml) and western blot (2.5μg/ml) applications.

Rabbit polyclonal anti-MyBL1 antibody is used to tag v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 in spermatocyte development.

Actions biochimiques/physiologiques

MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5′-YAAC[GT]G-3′. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.

Séquence

Synthetic peptide located within the following region: PRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable