Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV32303

Sigma-Aldrich

Anti-FOXL1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Forkhead box L1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

36 kDa

Espèces réactives

bovine, horse, human, pig, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FOXL1(2300)

Description générale

The Forkhead Box L1 (FoxL1) is a transcription factor that modulates epithelial growth and gastrointestinal development. This transcription factor has been implicated in pancreatic and gastrointestinal carcinogenesis and can also function as prognostic biomarker for clear cell renal cell carcinoma. Studies in mce have also revealed that FoxL1 can function as a biological marker of the hepatic progenitor cells.
Rabbit Anti-FOXL1 antibody recognizes canine, human, and mouse FOXL1.

Immunogène

Synthetic peptide directed towards the N terminal region of human FOXL1

Application

Rabbit Anti-FOXL1 antibody can be used for western blot (2.5μg/ml) and IHC (4-8μg/ml) assays.

Actions biochimiques/physiologiques

FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.

Séquence

Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Feng-Qiang Yang et al.
International journal of clinical and experimental pathology, 7(1), 110-122 (2014-01-16)
The Forkhead Box L1 (Foxl1) transcription factor regulates epithelial proliferation and development of gastrointestinal tract, and has been implicated in gastrointestinal and pancreatic tumorigenesis. However, the role of Foxl1 in renal cancer development and progression remains to be elucidated. The
Sara D Sackett et al.
Hepatology (Baltimore, Md.), 49(3), 920-929 (2008-12-24)
The liver contains a population of small bipotential facultative progenitor cells that reconstitute liver function when mature hepatocytes or cholangiocytes are unable to proliferate. Mesenchymal markers, including members of the forkhead transcription factor gene family, have been detected in hepatic

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique