Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

AV31375

Sigma-Aldrich

Anti-EN2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-AUTS1, Anti-AUTS10, Anti-Engrailed homeobox 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

34 kDa

Espèces réactives

dog, mouse, guinea pig, horse, human, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... EN2(2020)

Description générale

Engrailed homeodomain-containing transcription factors play crucial roles in brain development across many species, including the determination of the hindbrain/midbrain border, cerebellar patterning and aiding in neuronal axon guidance. Engrailed-2 (En-2) gene is expressed across the mesencephalon/metencephalon (mes/met) boundary in the cerebellar primordium. Engrailed-2 is involved in the determination of skeletal muscle physiologic properties. Urinary EN2 is a highly specific and sensitive candidate biomarker of prostate cancer.
Rabbit polyclonal anti-ENS antibody reacts with chicken, zebrafish, human, mouse, and rat engrailed homeobox 2 transcription factors.

Immunogène

Synthetic peptide directed towards the C-terminal region of Human EN2

Application

Rabbit Anti-EN2 antibody is suitable for use in western blot (0.5μg/ml) assays.
Rabbit polyclonal anti-ENS antibody is used to tag engrailed homeobox 2 transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of engrailed homeobox 2 transcription factor in brain development and skeletal muscle differentiation.

Actions biochimiques/physiologiques

Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.

Séquence

Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique