Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV09037

Sigma-Aldrich

Anti-SREBF2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-SREBP2, Anti-Sterol Regulatory element binding transcription factor 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Numéro MDL:
MFCD02264111
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

124 kDa

Espèces réactives

rat, guinea pig, dog, human, bovine, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_004590

Numéro d'accès UniProt

Q12772

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SREBF2(6721)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the middle region of human SREBF2

Application

Anti- SREBF2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

Sterol Regulatory Element-Binding Proteins (SREBPs) are transcription factors that are required for metabolic reprogramming and membrane synthesis in CD8+ T cells during the transition from quiescence to activation. SREBF2 is a transcriptional regulator of genes involved in cholesterol biosynthesis and lipid homeostasis.

Séquence

Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Guido T Bommer et al.
Cell metabolism, 13(3), 241-247 (2011-03-02)
The sterol regulatory element-binding factor-2 (SREBF2) gene is a bifunctional locus encoding SREBP-2, a well-known transcriptional regulator of genes involved in cholesterol biosynthesis, and microRNA-33a, which has recently been shown to reduce expression of proteins involved in export of cholesterol
Yoko Kidani et al.
Nature immunology, 14(5), 489-499 (2013-04-09)
Newly activated CD8(+) T cells reprogram their metabolism to meet the extraordinary biosynthetic demands of clonal expansion; however, the signals that mediate metabolic reprogramming remain poorly defined. Here we demonstrate an essential role for sterol regulatory element-binding proteins (SREBPs) in
Veerle W Daniëls et al.
PloS one, 9(9), e106913-e106913 (2014-09-13)
Increased lipogenesis is a hallmark of a wide variety of cancers and is under intense investigation as potential antineoplastic target. Although brisk lipogenesis is observed in the presence of exogenous lipids, evidence is mounting that these lipids may adversely affect

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique