171596

β-Amyloid Peptide

≥80% (HPLC), lyophilized, 1-42, rat

• Synonyme(s) : β-Amyloid Peptide (1-42), Rat, DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
• Formule empirique (notation de Hill): C₁₉₉H₃₀₇N₅₃O₅₉S
• Numéro CAS: 107761-42-2
• Poids moléculaire : 4417.95
• Numéro MDL: MFCD00163049
• Code UNSPSC : 12352202
• Nomenclature NACRES : NA.26

Propriétés

• product name: β-Amyloid Peptide (1-42), Rat,
• Description: Predominant peptide found in the brain of patients with Alzheimer′s Disease and Down′s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
• Niveau de qualité: 100
• Pureté: ≥80% (HPLC)
• Forme: lyophilized
• Fabricant/nom de marque: Calbiochem^®
• Conditions de stockage: OK to freeze; desiccated (hygroscopic)
• Solubilité: 5% acetic acid: 1 mg/mL
• Conditions d'expédition: ambient
• Température de stockage: −20°C

Description

Description générale

β-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer′s diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.

Predominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

Avertissement

Toxicity: Standard Handling (A)

Séquence

H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Autres remarques

Paradis, E., et al. 1996. J. Neurosci.16, 7533.
Roher, A.E., et al. 1996. J. Biol. Chem.271, 20631.
Soto, C., and Castano, E.M. 1996. Biochem. J.314, 701.
Murrell, J., et al. 1991. Science254, 97.
Goldgaber, D., et al. 1987. Science235, 877.
Kang, J., et al. 1987. Nature 325, 733.

Informations légales

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable