HPA049374
Anti-SNX6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-sorting nexin 6
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SNX6(58533)
Related Categories
General description
Sorting nexin 6 (SNX6) has N-terminal phosphoinositide‐binding phox homology (PX) domain and a C-terminal BAR (Bin/amphiphysin/Rvc) domain. The SNX6 gene is mapped to human chromosome 14q13.1. It is expressed in two isoforms and has high expression in heart, skeletal muscle, and placenta. It shows low expression in lungs and liver.
Immunogen
sorting nexin 6 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Sorting nexin 6 (SNX6) is involved in endosomal sorting. It interacts with receptor serine-threonine kinases and transforming growth factor-β (TGF-β) family of peptides. It coordinates with sorting nexin 5 (SNX5) and hinders phosphatidylinositol phosphate kinases (PIPKIγi5)-mediated E-cadherin degradation. SNX6 mediates the transport of cation-independent mannose-6-phosphate (CI-MPR) from endosome to trans-Golgi-network. SNX6 interacts with dynein motor complex and regulates the formation of tubular retrograde intermediates. SNX6 interacts with lamin A and regulates its synthesis and incorporation into the nuclear envelope.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST85090
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases
Parks WT, et al.
The Journal of Biological Chemistry, 276(22), 19332-19339 (2001)
The retromer component SNX6 interacts with dynactin p150 Glued and mediates endosome-to-TGN transport
Hong Z, et al.
Cell Research, 19(12), 1334-1349 (2009)
14q13. 1-21.1 deletion encompassing the HPE8 locus in an adolescent with intellectual disability and bilateral microphthalmia, but without holoprosencephaly
Piccione M, et al.
American Journal of Medical Genetics. Part A, 158(6), 1427-1433 (2012)
Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules
Van W, et al.
The Embo Journal, 31(23), 4466-4480 (2012)
A loss-of-function screen reveals SNX5 and SNX6 as potential components of the mammalian retromer
Wassmer T, et al.
Journal of Cell Science, 120(1), 45-54 (2007)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service