Skip to Content
Merck
All Photos(1)

Key Documents

AV48665

Sigma-Aldrich

Anti-METTL1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-C12orf1, Anti-Methyltransferase like 1, Anti-TRM8, Anti-YDL201w

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

rat, goat, bovine, rabbit, guinea pig, dog, mouse, horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... METTL1(4234)

General description

Anti-METTL1 antibody codes for methyltransferase like 1 that has an S-adenosylmethionine-binding motif. It is inactivated upon phosphorylation by PKB and RSK. A functional variant in METTL1, along with other genetic variants, has been associated with multiple sclerosis.
Rabbit Anti-METTL1 antibody recognizes bovine, human, mouse, and rat METTL1.

Immunogen

Synthetic peptide directed towards the middle region of human METTL1

Application

Rabbit Anti-METTL1 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.

Sequence

Synthetic peptide located within the following region: KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Antonio Alcina et al.
Journal of medical genetics, 50(1), 25-33 (2012-11-20)
Several studies have highlighted the association of the 12q13.3-12q14.1 region with coeliac disease, type 1 diabetes, rheumatoid arthritis and multiple sclerosis (MS); however, the causal variants underlying diseases are still unclear. The authors sought to identify the functional variant of
Robert A Cartlidge et al.
The EMBO journal, 24(9), 1696-1705 (2005-04-30)
A substrate for protein kinase B (PKB)alpha in HeLa cell extracts was identified as methyltransferase-like protein-1 (METTL1), the orthologue of trm8, which catalyses the 7-methylguanosine modification of tRNA in Saccharomyces cerevisiae. PKB and ribosomal S6 kinase (RSK) both phosphorylated METTL1

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service