WH0057526M4

Monoclonal Anti-PCDH19 antibody produced in mouse

clone 2G10, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-DKFZp686P1843, Anti-KIAA1313, Anti-protocadherin 19
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2G10, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_020766
• UniProt-Hinterlegungsnummer: Q8TAB3
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PCDH19(57526)

Beschreibung

Allgemeine Beschreibung

Protocadherin 19 (PCDH19) is part of the d-protocadherin superfamily. It is expressed in the brain. The gene encoding this calcium-dependent cell adhesion protein is localized on human chromosome Xq22.1.

Immunogen

PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR

Biochem./physiol. Wirkung

Protocadherin 19 (PCDH19) has been associated with female-specific epilepsy and an X-linked model of neurological disease. It has a role in neuronal organization and migration. PCDH19 is also involved in cell-cell and cell-matrix adhesion.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)