WH0005156M1

Monoclonal Anti-PDGFRA antibody produced in mouse

clone 2D2-1A11, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-CD140A, Anti-MGC74795, Anti-PDGFR2, Anti-platelet-derived growth factor receptor, alpha polypeptide
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2D2-1A11, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• GenBank-Hinterlegungsnummer: BC015186
• UniProt-Hinterlegungsnummer: P16234
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PDGFRA(5156)

Beschreibung

Allgemeine Beschreibung

This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes. (provided by RefSeq)
Platelet-derived growth factor receptor α (PDGFRA) is also termed as cluster of differentiation 140a (CD140a). It is is encoded by the gene mapped to human chromosome 4q12. The encoded protein belongs to the receptor tyrosine kinase gene family.

Immunogen

PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL

Biochem./physiol. Wirkung

Platelet-derived growth factor receptor α (PDGFRA) plays a vital role in the development and maturation of platelets. It serves as a potential target for imatinib, a revolutionary drug for the treatment of chronic myeloid leukemia. PDGFRA pathway may participate in the developmental process of thrombocytes. Mutation in the gene results in gastrointestinal stromal tumors (GISTs).

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)