WH0000208M1

Monoclonal Anti-AKT2 antibody produced in mouse

clone 1B3, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-PKBBETA, Anti-PRKBB, Anti-RACBETA, Anti-v-akt murine thymoma viral oncogene homolog 2
• MDL-Nummer: MFCD01633020
• UNSPSC-Code: 12352203
• NACRES: NA.41
• Konjugat: unconjugated
• application: ELISA (i); IF; WB
• Klon: 1B3, monoclonal
• Speziesreaktivität: human
• citations: 2
• Methode(n): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1B3, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• GenBank-Hinterlegungsnummer: M95936
• UniProt-Hinterlegungsnummer: P31751
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... AKT2(208)

Beschreibung

Allgemeine Beschreibung

This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. (provided by RefSeq)

Immunogen

AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)