SAB2108709

Anti-SCN8A

affinity isolated antibody

• Synonym(e): Anti- MED, Anti- NaCh6, Anti- Nav1.6, Anti- PN4, Anti-CerIII
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 225 kDa
• Speziesreaktivität: mouse, horse, rabbit, rat, human, bovine, dog, guinea pig
• Konzentration: 0.5-1 mg/mL
• Methode(n): immunoblotting: suitable
• Hinterlegungsnummer: NM_014191
• UniProt-Hinterlegungsnummer: Q9UQD0
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SCN8A(6334)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human SCN8A

Biochem./physiol. Wirkung

Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells.

Sequenz

Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable