SAB2102759

Anti-ZEB1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-AREB6, Anti-BZP, Anti-MGC133261, Anti-NIL-2-A, Anti-Zinc finger E-box binding homeobox 1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 124 kDa
• Speziesreaktivität: dog, human, mouse, guinea pig, rabbit, rat
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunofluorescence: suitable; western blot: suitable
• UniProt-Hinterlegungsnummer: P37275
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ZEB1(6935)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human ZEB1

Biochem./physiol. Wirkung

ZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM].

Sequenz

Synthetic peptide located within the following region: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGH

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable