SAB2101563

Anti-NEDD9 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-CAS-L, Anti-CASL, Anti-DJ49G10.2, Anti-HEF1, Anti-Neural precursor cell expressed, developmentally down-regulated 9
• UNSPSC-Code: 12352203
• NACRES: NA.41
• Klon: polyclonal
• application: IHC; WB
• Speziesreaktivität: guinea pig, rat, rabbit, human, mouse
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• citations: 1

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 93 kDa
• Speziesreaktivität: guinea pig, rat, rabbit, human, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• UniProt-Hinterlegungsnummer: Q14511
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... NEDD9(4739)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human NEDD9

Biochem./physiol. Wirkung

Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.

Sequenz

Synthetic peptide located within the following region: DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable