SAB2100641

Anti-EARS2 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Glutamyl-tRNA synthetase 2, mitochondrial (putative), Anti-KIAA1970, Anti-MSE1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 59 kDa
• Speziesreaktivität: human, rat
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• UniProt-Hinterlegungsnummer: Q5JPH6
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EARS2(124454)

Beschreibung

Allgemeine Beschreibung

The previously assigned protein identifier Q86YH3 has been merged into Q5JPH6. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the middle region of human EARS2

Biochem./physiol. Wirkung

EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.

Sequenz

Synthetic peptide located within the following region: TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable