SAB1412075

ANTI-TEK antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CD202B, TEK, TIE-2, TIE2, VMCM
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2D7, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 36.41 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: BC035514
• UniProt-Hinterlegungsnummer: Q02763
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TEK(7010)

Beschreibung

Allgemeine Beschreibung

The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase. (provided by RefSeq)

Immunogen

TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable