SAB1411943

ANTI-EPHB3 antibody produced in mouse

clone 4E9, purified immunoglobulin, buffered aqueous solution

• Synonym(e): EPHB3, ETK2, HEK2, TYRO6
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 4E9, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen 36.63 kDa
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• NCBI-Hinterlegungsnummer: NM_004443
• UniProt-Hinterlegungsnummer: P54753
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EPHB3(2049)

Beschreibung

Allgemeine Beschreibung

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. (provided by RefSeq)

Immunogen

EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable