SAB1404683

Monoclonal Anti-DCAMKL1, (C-terminal) antibody produced in mouse

clone 6H4, purified immunoglobulin, buffered aqueous solution

• Synonym(e): DCAMKL1, DCDC3A, DCLK, KIAA0369
• UNSPSC-Code: 12352203
• NACRES: NA.41
• Konjugat: unconjugated
• application: ELISA (c); ELISA (i); IF; WB
• Klon: 6H4, monoclonal
• Speziesreaktivität: mouse, human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 6H4, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~35.9 kDa
• Speziesreaktivität: mouse, human
• Methode(n): capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG
• NCBI-Hinterlegungsnummer: NM_004734
• UniProt-Hinterlegungsnummer: O15075
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... DCLK1(9201)

Beschreibung

Allgemeine Beschreibung

DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]).[supplied by OMIM

Immunogen

DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable