SAB1402284

Monoclonal Anti-NCBP1 antibody produced in mouse

clone 1E9, purified immunoglobulin, buffered aqueous solution

• Synonym(e): CBP80, MGC2087, NCBP
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1E9, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~36.89 kDa
• Speziesreaktivität: human
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• NCBI-Hinterlegungsnummer: NM_002486
• UniProt-Hinterlegungsnummer: Q09161
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NCBP1(4686)

Beschreibung

Allgemeine Beschreibung

The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5′ cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3′-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. (provided by RefSeq)

Immunogen

NCBP1 (NP_002477, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable