SAB1401551

Monoclonal Anti-SDS antibody produced in mouse

clone 1A9, purified immunoglobulin, buffered aqueous solution

• Synonym(e): SDH
• UNSPSC-Code: 12352203
• NACRES: NA.41
• Konjugat: unconjugated
• application: ELISA (c); WB
• Klon: 1A9, monoclonal
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; western blot: 1-5 μg/mL

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 1A9, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• NCBI-Hinterlegungsnummer: BC020750
• UniProt-Hinterlegungsnummer: P20132
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SDS(10993)

Beschreibung

Allgemeine Beschreibung

This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver. (provided by RefSeq)

Immunogen

SDS (AAH20750, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable