HPA039557

Anti-TAZ antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-BTHS, Anti-CMD3A, Anti-EFE, Anti-EFE2, Anti-G4.5, Anti-Tafazzin, Anti-XAP-2
• MDL-Nummer: MFCD03792065
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA039557
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunohistochemistry: 1:20- 1:50
• Immunogene Sequenz: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP
• UniProt-Hinterlegungsnummer: Q16635
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TAZ(6901)

Beschreibung

Allgemeine Beschreibung

Tafazzin (TAZ) is encoded by the WW domain containing transcription regulator 1 (WWTR1) gene mapped to human chromosome Xq28. The encoded protein contains 400 amino acids. It is characterized by a conserved WW domain, implicated in binding PPXY motif, a coiled-coil region associated with protein-protein interaction and a C-terminal motif involved in binding the PDZ domain.

Immunogen

tafazzin recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-TAZ antibody produced in rabbit has been used in immunohistochemistry and immunoprecipitation.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem./physiol. Wirkung

Tafazzin (TAZ) plays a vital role in the various cellular process including cell proliferation, differentiation, apoptosis, migration, invasion, epithelial-mesenchymal transition (EMT) and stemness in multiple human cancers. TAZ associates with other transcription factors such as RUNX2 (runt-related transcription factor 2), PPAR (peroxisome proliferator-activated receptor), PAX3 and 8 (paired box gene 3 and 8) and TTF1 (thyroid transcription factor 1) and plays an essential role in osteoblastic, myogenic and adipogenic differentiation.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST77964

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable