HPA038421

Anti-WDR48 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-KIAA1449, Anti-P80, Anti-SPG60
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA038421
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: independent; Learn more about Antibody Enhanced Validation
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200; western blot: 0.04-0.4 μg/mL
• Immunogene Sequenz: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
• UniProt-Hinterlegungsnummer: Q8TAF3
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... WDR48(57599)

Beschreibung

Allgemeine Beschreibung

The gene WDR48 (WD repeat domain 48) is mapped to human chromosome 3p22.2. It is a cofactor for deubiquitinating enzymes USP1 (ubiquitin specific peptidase 1), USP12 and USP46.

Immunogen

WD repeat domain 48 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-WDR48 antibody produced in rabbit has been used in western blotting.

Biochem./physiol. Wirkung

USP1-WDR48 (ubiquitin specific peptidase 1 - WD repeat domain 48) complex is involved in DNA damage responses. It is responsible for repair of interstrand DNA crosslinks through the Fanconi anemia pathway. It also reverses monoubiquitination of PCNA (proliferating cell nuclear antigen) and regulates translesion synthesis, a DNA damage tolerance response. This complex also participates in homologous recombination. USP1-WDR48 complex mainly controls nuclear protein ubiquitination. WDR48 also works as a tumor suppressor by enhancing PHLPP1 (PH domain leucine-rich repeat protein phosphatase 1) stability. The WDR48 - USP12 complex is responsible for deubiquitination of PHLPP1, which is needed for tumor suppressor function.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST79337

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable