HPA029025

Anti-INTS11 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-CPSF3L, Anti-CPSF73L, Anti-FLJ20542, Anti-INT11, Anti-RC-68, Anti-INTS11, Anti-cleavage and polyadenylation specific factor 3-like
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA029025
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: RNAi knockdown; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: LVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALK
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CPSF3L(54973)

Beschreibung

Allgemeine Beschreibung

The gene CPSF3L (cleavage and polyadenylation-specific factor 3-like, also referred to as INTS11 (integrator complex subunit 11)) is mapped to human chromosome 1p36.33. The protein is present in the cytoplasm and nucleus. It forms a heterodimer with INTS9 and the dimer is responsible for snRNA (small nuclear RNA) 3′ end processing.

Immunogen

integrator complex subunit 11 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-CPSF3L antibody produced in rabbit has been used in western blotting.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST76720

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable