HPA019711

Anti-LANCL2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-LanC-like protein 2, Anti-Testis-specific adriamycin^® sensitivity protein
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA019711
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: ALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY
• UniProt-Hinterlegungsnummer: Q9NS86
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... LANCL2(55915)

Beschreibung

Allgemeine Beschreibung

LANCL2 (LanC lantibiotic synthetase component C-like 2) is a highly conserved plasma membrane associated protein belonging to the eukaryotic lanthionine synthetase component C-like (LANCL) protein family. It is located on chromosome 7 and localized to the plasma membrane, juxta-nuclear vesicles, and the nucleus. It is widely distributed protein in several human tissues such as brain and in testis. It consists of 15 cysteine residues, N-terminal PIP-binding motif with the polybasic region KRLKLH.

Immunogen

LanC-like protein 2 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

LANCL2 (LanC lantibiotic synthetase component C-like 2) plays a crucial role in the membrane association and in cortical cytoskeleton organization. During membrane restructuring, its N-terminal putative myristoylation site directly interacts with PI (phosphatidylinositol) monophosphates. It also plays an important role in the membrane association and cellular sensitivity to the anticancer drug Adriamycin through myristoylation. It has been reported that LANCL2 overexpression enhances cell detachment upon cholesterol depletion. LANCL2 is involved in the ABA (Abscisic Acid) signaling pathway. It helps ABA to bind on the membrane of human granulocytes.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74971

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Adriamycin is a registered trademark of RDF Pharmacia & Upjohn S.P.A.

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable