HPA018999

Anti-GLTSCR2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Glioma tumor suppressor candidate region gene 2 protein, Anti-p60
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA018999

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: REAEADKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GLTSCR2(29997)

Beschreibung

Allgemeine Beschreibung

The gene GLTSCR2 (glioma tumor suppressor candidate region gene 2 protein) is mapped to human chromosome 19q. The protein localizes in the nucleolus and the nucleoplasm. GLTSCR2 is also called as PICT1 (PTEN carboxyl terminus 1).

Immunogen

Glioma tumor suppressor candidate region gene 2 protein recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-GLTSCR2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

GLTSCR2 (glioma tumor suppressor candidate region gene 2) regulates expression of tumor suppressor p53. It suppresses transfer of ribosomal protein L11 to the nucleoplasm. In the nucleoplasm, L11 inhibits E3 ubiquitin-protein ligase, MDM2 (Mouse double minute 2), resulting in p53 activation. In presence of ribosomal stress GLTSCR2 moves to the nucleoplasm and stabilizes p53, thereby inhibiting cell cycle progression. GLTSCR2 plays an important role in cellular respiration. GLTSCR2 is down-regulated in cervical cancer, squamous cell carcinoma, prostatic adenocarcinoma and breast cancer. On the other hand, GLTSCR2 is involved in gastric cancer progression.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74821

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable