HPA016909

Anti-DCBLD2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-CUB, LCCL and coagulation factor V/VIII-homology domains protein 1, Anti-Discoidin, CUB and LCCL domain-containing protein 2, Anti-Endothelial and smooth muscle cell-derived neuropilin-like protein
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA016909
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST
• UniProt-Hinterlegungsnummer: Q96PD2
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... DCBLD2(131566)

Beschreibung

Allgemeine Beschreibung

DCBLD2 (discoidin, CUB and LCCL domain containing 2) is a novel neuropilin-like type-I transmembrane protein belonging to the neuropilin family. It is expressed in endothelial cells specifically in vascular smooth muscle cells. It is composed of a CUB domain and a coagulation factor V/VIII homology domain.

Immunogen

Discoidin, CUB and LCCL domain-containing protein 2 Precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-DCBLD2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem./physiol. Wirkung

DCBLD2 (discoidin, CUB and LCCL domain containing 2) is highly involved in the regulation of vascular cell growth. It possesses tumor suppressive property, where it can suppress the cell migration signaling, and invasion of cancer cells. It acts as a potential gene for the miR-451a-mediated regulation in hypopharyngeal squamous cell carcinoma (HSCC). DCBLD2 regulates PDGFRβ (Platelet-derived growth factor receptor β) signaling by modulating receptor ubiquitination in vascular smooth muscle cells.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71630

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable