HPA008999

Anti-EFNB2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-EPH-related receptor tyrosine kinase ligand 5 antibody produced in rabbit, Anti-Ephrin-B2 precursor antibody produced in rabbit, Anti-HTK ligand antibody produced in rabbit, Anti-HTK-L antibody produced in rabbit, Anti-LERK-5 antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA008999
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
• UniProt-Hinterlegungsnummer: P52799
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EFNB2(1948)

Beschreibung

Allgemeine Beschreibung

EFNB2 (ephrin-B2) is a member of the B-class ephrins, which function as ligands for EphB RTKs (receptor tyrosine kinase). It is a transmembrane protein. It is a cell surface signaling glycoprotein, which has a ubiquitous expression pattern. EFNB2 is expressed in mesenchymal cells, with the highest expression in fibroblast. EFNB2 gene is located on human chromosome 13q33.3.

Immunogen

Ephrin-B2 precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-EFNB2 antibody produced in rabbit has been used in:

• immunohistochemistry (1:100)
• western blot analysis (1:1000)
• immunostaining

Anti-EFNB2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

Ephrin-B2 (EFNB2) regulates sprouting and proliferation of endothelial cells in the endothelium of the developing vasculature. This is in turn, linked with vascular endothelial growth factor (VEGF) receptor endocytosis and signaling. It is crucial in supporting pericytes and vascular smooth muscle cells (VSMCs). It also functions as the regulator of the distribution, internalization and signaling of platelet-derived growth factor receptor β (PDGFRβ) in VSMCs. In castration resistant prostate cancer (CRPC), the expression of this gene is directly suppressed by miR-582-5p. Therefore, it might function as a tumor suppressor functioning through EphB4, in cancer cells expressing EphB4. This protein is responsible for the induction of neuronal differentiation of neural stem cells (NSCs), when presented by neighbouring astrocytes. EFNB2 participates in the development of the cardiovascular system, postnatal angiogenesis, and cardiac remodeling. It serves as a modulator in transforming growth factor-ß (TGF-ß)-mediated organ fibrosis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71886

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)