HPA008773

Anti-CA12 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-CA-XII antibody produced in rabbit, Anti-Carbonate dehydratase XII antibody produced in rabbit, Anti-Carbonic anhydrase 12 precursor antibody produced in rabbit, Anti-Carbonic anhydrase XII antibody produced in rabbit, Anti-Tumor antigen HOM-RCC-3.1.3 antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA008773
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
• UniProt-Hinterlegungsnummer: O43570
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CA12(771)

Beschreibung

Allgemeine Beschreibung

CA12 (carbonic anhydrase XII) gene is localized to human chromosome 15q22. This gene is predominantly expressed in adult pancreas, colon, kidney and prostate. It belongs to α CA gene family, and is composed of a leader sequence, an α CA domain, a transmembrane region and a short cytoplasmic domain.

Immunogen

Carbonic anhydrase 12 precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-CA12 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

CA12 (carbonic anhydrase XII) catalyzes the hydration of CO₂ generated by cells into bicarbonate and protons. Expression of this enzyme in oral squamous cell carcinoma (OSCC) is related to tumor progression and poor prognosis. The expression levels of this enzyme are also linked to the histological grade of cervical cancer, and absence of its expression correlates with poorly differentiated phenotype. The presence of this enzyme marginally links with better disease-free survival of cervical cancer patients.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71649

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)