HPA007875

Anti-MMP3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-MMP-3 antibody produced in rabbit, Anti-Matrix metalloproteinase-3 antibody produced in rabbit, Anti-SL-1 antibody produced in rabbit, Anti-Stromelysin-1 precursor antibody produced in rabbit, Anti-Transin-1 antibody produced in rabbit
• MDL-Nummer: MFCD01094317
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA007875
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
• UniProt-Hinterlegungsnummer: P08254
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MMP3(4314)

Beschreibung

Allgemeine Beschreibung

MMP3 (matrix metallopeptidase 3) gene is a part of a gene cluster that encodes matrix metalloproteinases (MMP) and is localized to human chromosome 11q22.3. MMPs are a family of 23 members that are induced by the cytokine tumor necrosis factor (TNF)-α. These proteinases are secreted in an inactive form and are activated upon cleavage by certain proteinases.

Immunogen

Stromelysin-1 precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-MMP3 antibody produced in rabbit has been used for global protein profiling to find new molecular biomarkers for common, multifactorial disorders.
Anti-MMP3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

Matrix metallopeptidase 3 (MMP3) has a broad substrate specificity and is capable of degrading fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. This enzyme functions is several physiological processes, such as in wound repair, progression of atherosclerosis, tissue remodeling and tumor initiation. MMP3 variant can be associated with hypertrophy of interventricular septum or hypertrophic cardiomyopathy. It may serves as a non-invasive biomarker of histological synovitis and diagnosis of rheumatoid arthritis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70114

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)