HPA005525

Anti-PRMT5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-72 kDa ICln-binding protein antibody produced in rabbit, Anti-Jak-binding protein 1 antibody produced in rabbit, Anti-Protein arginine N-methyltransferase 5 antibody produced in rabbit, Anti-SKB1Hs antibody produced in rabbit, Anti-Shk1 kinase-binding protein 1 homolog antibody produced in rabbit
• MDL-Nummer: MFCD03455973
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA005525
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human, mouse, rat
• Erweiterte Validierung: RNAi knockdown; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF
• UniProt-Hinterlegungsnummer: O14744
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... PRMT5(10419)

Beschreibung

Allgemeine Beschreibung

PRMT5 (protein arginine methyltransferase 5) belongs to the family of protein methyltransferases. It is a human homologue of Schizosaccaromyces pombe Skb1 (Shk1 kinase-binding protein 1), and Saccharomyces cerevisiae HSL7 (histone synthetic lethal 7) proteins. This gene is localized to the chromosome 14q11.2-21. It contains the motif characteristic of protein arginine methyltransferase (PRMT) family, which are S-adenosyl-L-methionine-dependent. This protein is a type II arginine methyltransferase. It is predominantly expressed in the cytoplasm.

Immunogen

Protein arginine N-methyltransferase 5 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-PRMT5 antibody is suitable for immunoprecipitation and ChIP (chromatin immunoprecipitation).
Anti-PRMT5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

PRMT5 (protein arginine methyltransferase 5) forms monomethylarginine or symmetrical dimethylarginine (MMA/sDMA) by methylating isolated arginine residues or arginine residues found in glycine- and arginine-rich (GAR) motifs. As it forms a part of various protein complexes, it plays essential roles in multiple cellular process. It regulates chromatin remodeling, leading to either gene activation or repression. Cell proliferation and survival is regulated by PRMT5, through extracellular signal-regulated kinase (ERK) pathway. It methylates CRAF (c-Rapidly Accelerated Fibrosarcoma) and BRAF (b-Rapidly Accelerated Fibrosarcoma), which in turn phosphorylate ERK protein. It methylates ribosomal protein S10 (RPS10) at the Arg (158) and Arg (160) residues. RPS10, in turn regulates the assembly of ribosomes, cell proliferation and protein synthesis. Therefore, PRMT5 is involved in tumorigenesis by regulating cell proliferation. PRMT5 is also associated with inflammation and related diseases, such as atherosclerosis, by regulating HOXA9, which has a pro-inflammatory function.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70548

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)