HPA003342

Anti-CXADR antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-CVB3-binding protein antibody produced in rabbit, Anti-Coxsackievirus B-adenovirus receptor antibody produced in rabbit, Anti-Coxsackievirus and adenovirus receptor precursor antibody produced in rabbit, Anti-HCVADR antibody produced in rabbit, Anti-hCAR antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA003342

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKI
• UniProt-Hinterlegungsnummer: P78310
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CXADR(1525)

Beschreibung

Allgemeine Beschreibung

CXADR (coxsackie virus and adenovirus receptor) is predominantly expressed in brain and systemic secretory organs such as the pancreas, testis, and small intestine. Its expression increases in models of myocardial inflammation and cardiac injury suggesting its role in inflammatory response.

Immunogen

Coxsackievirus and adenovirus receptor precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-CXADR antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Biochem./physiol. Wirkung

CXADR (coxsackie virus and adenovirus receptor) gene encodes a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. It functions both as a viral receptor and an adhesion molecule associated with tight junctions. CXADR induces stress-activated mitogen-activated protein kinase (MAPK) pathways in the heart, which results in increased production of IFNγ, IL-12, IL-1β, TNFα, and IL-6. These inflammatory cytokines are linked to M1 inflammatory response and this response is overactivated in Down′s syndrome (DS) due to increased expression of CXADR. The expression of this protein has been observed to be altered on the endothelial cells of the cerebrovasculature in DS patients leading to a change in infiltration of peripheral inflammatory cells into the brain. The protein also facilitates transendothelial migration of neutrophils.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86415

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)