HPA001432

Anti-HSD17B10 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-3-Hydroxy-2-methylbutyryl-CoA dehydrogenase antibody produced in rabbit, Anti-3-Hydroxyacyl-CoA dehydrogenase type II antibody produced in rabbit, Anti-3-Hydroxyacyl-CoA dehydrogenase type-2 antibody produced in rabbit, Anti-Endoplasmic reticulum-associated amyloid β-peptide-binding protein antibody produced in rabbit, Anti-Type II HADH, Anti-Type II HADH antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA001432
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: EAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQA
• UniProt-Hinterlegungsnummer: Q99714
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HSD17B10(3028)

Beschreibung

Allgemeine Beschreibung

HSD17B10 (hydroxysteroid (17-b) dehydrogenase 10) gene encodes a mitochondrial, multifunctional protein, 17β-hydroxysteroid dehydrogenase type 10. It is a homotetrameric protein belonging to the short-chain dehydrogenase/reductase superfamily.

Immunogen

3-Hydroxyacyl-CoA dehydrogenase type-2 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-HSD17B10 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

HSD17B10 (hydroxysteroid (17-β) dehydrogenase 10) is involved in the metabolism of fatty acids and steroid. It catalyzes the 2-methyl-3-hydroxybutyryl-CoA dehydrogenation (MHBD) reaction in isoleucine metabolism. It is a subunit of mitochondrial ribonuclease P and functions in the maturation of mitochondrial tRNA. It catalyzes the oxidation of several fatty acids and steroids. Defects in this gene cause 17β-hydroxysteroid dehydrogenase type 10 (HSD10) deficiency, that is characterized by progressive psychomotor regression and alteration of mitochondria morphology. It has been reported that HSD17B10 shows clinical importance in Alzheimer disease.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74041

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)