AV54329
Anti-IL4 antibody produced in rabbit
affinity isolated antibody
Synonym(e):
Anti-BSF1, Anti-IL-4, Anti-Interleukin 4, Anti-MGC79402
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(1)
About This Item
UNSPSC-Code:
12352203
NACRES:
NA.41
Empfohlene Produkte
Biologische Quelle
rabbit
Qualitätsniveau
Konjugat
unconjugated
Antikörperform
affinity isolated antibody
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Mol-Gew.
15 kDa
Speziesreaktivität
human
Konzentration
0.5 mg - 1 mg/mL
Methode(n)
western blot: suitable
NCBI-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
wet ice
Lagertemp.
−20°C
Angaben zum Gen
human ... IL4(3565)
Verwandte Kategorien
Immunogen
Synthetic peptide directed towards the middle region of human IL4
Anwendung
Anti-IL4 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem./physiol. Wirkung
Interleukin-4 (IL-4) is a T cell derived chemokine that stimulates the Th2 mediated immune response and proliferation of B cells. The effects of IL-4 are mediated by two types of receptors, type I receptor consisting of IL-4Rα and common γ chain and type II receptor composed of IL-4Rα and IL-13Rα1. The signalling stimulated by IL-4 leads to activation of JAK/STAT6 and IRS-mediated PI3K/Akt pathway. Through these pathways, IL-4 is responsible for endocytic activity of macrophages, chemotaxis of leukocytes in response to inflammation, angiogenesis and regulation of nitric oxide metabolism in macrophages. Anti-tumor effects of IL-4 have been reported in cancers of breast, liver and renal cells.
Sequenz
Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Hier finden Sie alle aktuellen Versionen:
Analysenzertifikate (COA)
Lot/Batch Number
Die passende Version wird nicht angezeigt?
Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Alberto Mantovani et al.
Trends in immunology, 25(12), 677-686 (2004-11-09)
Plasticity and functional polarization are hallmarks of the mononuclear phagocyte system. Here we review emerging key properties of different forms of macrophage activation and polarization (M1, M2a, M2b, M2c), which represent extremes of a continuum. In particular, recent evidence suggests
E M Coccia et al.
International immunology, 12(7), 977-985 (2000-07-06)
NO is a labile radical involved in several immunological, antimicrobial and inflammatory processes. In macrophages, NO formation is catalyzed by the cytokine-inducible enzyme inducible NO synthase (iNOS). The importance of IFN regulatory factor (IRF)-1 and of the signal transducers and
C K Oh et al.
European respiratory review : an official journal of the European Respiratory Society, 19(115), 46-54 (2010-10-20)
Asthma is a complex, persistent, inflammatory disease characterised by airway hyperresponsiveness in association with airway inflammation. Studies suggest that regular use of high-dose inhaled corticosteroids and long-acting bronchodilators or omalizumab (a humanised monoclonal antibody that binds to immunoglobulin E and
Jane Gilmour et al.
Immunology, 124(4), 437-444 (2008-05-16)
The mechanism of differentiation of naïve T cells to a variety of effector lineages, but particularly to T helper type 1 (Th1) and Th2 cells, has been the subject of intense scrutiny over the past two decades. Studies have revealed
Hao-Wei Wang et al.
Cell cycle (Georgetown, Tex.), 9(24), 4824-4835 (2010-12-15)
Although macrophages were originally recognized as major immune effector cells, it is now appreciated that they also play many important roles in the maintenance of tissue homeostasis, and are involved in a variety of pathological conditions including cancer. Several studies
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.