AV50256
Anti-CYTB antibody produced in rabbit
affinity isolated antibody
Synonym(e):
Anti-Cytochrome b
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(2)
About This Item
UNSPSC-Code:
12352203
Empfohlene Produkte
Biologische Quelle
rabbit
Qualitätsniveau
Konjugat
unconjugated
Antikörperform
affinity isolated antibody
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Mol-Gew.
42 kDa
Speziesreaktivität
human
Konzentration
0.5 mg - 1 mg/mL
Methode(n)
western blot: suitable
NCBI-Hinterlegungsnummer
Versandbedingung
wet ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... MTCYB(4519)
Allgemeine Beschreibung
Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is encoded by mitochondrial DNA.
Immunogen
Synthetic peptide directed towards the N terminal region of human CYTB
Anwendung
Anti-CYTB antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem./physiol. Wirkung
Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is a component of complex III mitochondrial respiratory chain. Mutations in CYTB are associated with hypertrophic cardiomyopathy and Leber′s hereditary optic neuropathy. CYTB is up-regulated in uterine leiomyomas compared with myometrium tissues. Homoplasmic alteration in CYTB has been associated with colorectal cancer. Mutation in CYTB is also detected in primary bladder cancer patient. Cleaved CYTB protein functions as cytoplasmic mediator of FAS-induced apoptosis.
Sequenz
Synthetic peptide located within the following region: TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Christian M Hagen et al.
Molecular genetics & genomic medicine, 1(1), 54-65 (2014-02-06)
Mitochondrial dysfunction is a characteristic of heart failure. Mutations in mitochondrial DNA, particularly in MT-CYB coding for cytochrome B in complex III (CIII), have been associated with isolated hypertrophic cardiomyopathy (HCM). We hypothesized that MT-CYB mutations might play an important
M D Brown et al.
Genetics, 130(1), 163-173 (1992-01-01)
Four new missense mutations have been identified through restriction analysis and sequencing of the mitochondrial DNAs (mtDNA) from Leber's hereditary optic neuropathy (LHON) patients who lacked the previously identified 11778 mutation. Each altered a conserved amino acid and correlated with
Noor Ahmad Shaik et al.
Gynecological endocrinology : the official journal of the International Society of Gynecological Endocrinology, 27(12), 1094-1098 (2011-04-22)
The relative expression levels of estrogen receptor α (ERα) and mitochondrial cytochrome b (MTCYB) transcripts and their association with ERα, -397T > C gene polymorphism was determined in premenopausal uterine leiomyomas and myometrium tissues to gain an insight into the
Naoto Chihara et al.
Journal of Nippon Medical School = Nippon Ika Daigaku zasshi, 78(1), 13-21 (2011-03-11)
Somatic mutations of mitochondrial DNA (mtDNA) have been reported in different types of cancers and are suggested to play roles in metastasis, cancer development and response to anticancer agents. To predict potential roles of mtDNA alterations in colorectal cancer, we
Santanu Dasgupta et al.
International journal of cancer, 125(12), 2829-2835 (2009-07-02)
Mitochondria encoded Cytochrome B (CYTB) gene mutations were reported in tumors of different anatomic origin but the functional significance of these mutations are not well studied. Earlier, we found a 7-amino acid deletion mutation in the CYTB gene in a
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.