AV48498

Anti-TTC6 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-MGC119358, Anti-MGC119360, Anti-MGC119361, Anti-Tetratricopeptide repeat domain 6
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 59 kDa
• Speziesreaktivität: human, rabbit, mouse, horse, dog, bovine, pig
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001007796
• UniProt-Hinterlegungsnummer: Q86TZ1
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... TTC6(115669)

Beschreibung

Allgemeine Beschreibung

TTC6 codes for tetratricopeptide repeat domain 6 protein. It has been identified as a susceptibility locus for allergic diseases.
Rabbit Anti-TTC6 antibody recognizes human, canine, and mouse TTC6.

Immunogen

Synthetic peptide directed towards the C terminal region of human TTC6

Anwendung

Rabbit Anti-TTC6 antibody is suitable for western blot applications at a concentration of 0.5μg/ml.

Biochem./physiol. Wirkung

The functions of TTC6 remain unknown.

Sequenz

Synthetic peptide located within the following region: MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable