AV43773

Anti-SLC10A5 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-P5, Anti-Solute carrier family 10 (sodium/bile acid cotransporter family), member 5
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 48 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001010893
• UniProt-Hinterlegungsnummer: Q5PT55
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... SLC10A5(347051)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC10A5

Biochem./physiol. Wirkung

SLC10A5 is a member of solute carrier (SLC) family 10 of transporters involved in the influx of bile acids, steroidal hormones and various drugs. This member is particularly involved in the transport of solutes.

Sequenz

Synthetic peptide located within the following region: GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable