Direkt zum Inhalt
Merck

AV42455

Sigma-Aldrich

Anti-ABHD5 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(e):

Anti-Abhydrolase domain containing 5, Anti-CDS, Anti-CGI58, Anti-IECN2, Anti-MGC8731, Anti-NCIE2

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

IgG fraction of antiserum

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

39 kDa

Speziesreaktivität

rabbit, dog, bovine, mouse, rat, sheep, human, horse

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Angaben zum Gen

human ... ABHD5(51099)

Allgemeine Beschreibung

ABHD5/CGI58 product 1-acylglycerol-3-phosphate O-acyltransferase is a signaling agent that co-activates adipose triglyceride lipase and acylation of lysophosphatidic acid (LPA). ABHD5 (1-acylglycerol-3-phosphate O-acyl-transferase) is a member of the esterase/lipase/thioesterase subfamily that has been associated with a triglyceride storage disease involving impaired long-chain fatty acid oxidation, known as Chanarin-Dorfman syndrome, a rare neutral lipid disorder characterised by icthyosis, hepatic steatosis.

Spezifität

Anti-ABHD5/CGI58 antibody reacts with a sequence of the enzyme human1-acylglycerol-3-phosphate O-acyltransferase.

Immunogen

Synthetic peptide directed towards the N terminal region of human ABHD5

Anwendung

Anti-ABHD5/CGI58 is a rabbit IgG polyclonal antibody used to tag comparative gene identification 58 (CGI58) proteins for detection and quantitation by Western blotting and in tissues by immunohistochemical (IHC) techniques.

Biochem./physiol. Wirkung

ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.

Sequenz

Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 3

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Caleb C Lord et al.
Diabetes, 61(2), 355-363 (2012-01-10)
Mutations of comparative gene identification 58 (CGI-58) in humans cause Chanarin-Dorfman syndrome, a rare autosomal recessive disease in which excess triacylglycerol (TAG) accumulates in multiple tissues. CGI-58 recently has been ascribed two distinct biochemical activities, including coactivation of adipose triglyceride
Ananda K Ghosh et al.
The Journal of biological chemistry, 283(36), 24525-24533 (2008-07-09)
cgi-58 (comparative gene identification-58) is a member of alpha/beta-hydrolase family of proteins. Mutations in CGI-58 are shown to be responsible for a rare genetic disorder known as Chanarin-Dorfman syndrome, characterized by an excessive accumulation of triacylglycerol in several tissues and
Gabriela Montero-Moran et al.
Journal of lipid research, 51(4), 709-719 (2009-10-06)
Mutations in human CGI-58/ABHD5 cause Chanarin-Dorfman syndrome (CDS), characterized by excessive storage of triacylglycerol in tissues. CGI-58 is an alpha/beta-hydrolase fold enzyme expressed in all vertebrates. The carboxyl terminus includes a highly conserved consensus sequence (HXXXXD) for acyltransferase activity. Mouse

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.