AV37392

Anti-TTC19 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 39 kDa
• Speziesreaktivität: mouse, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_082636
• UniProt-Hinterlegungsnummer: Q5NCZ4
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: mouse ... TTC19(72795)

Beschreibung

Allgemeine Beschreibung

TTC19 contains a tetratricopeptide repeat (TPR) domain that is believed to be involved in protein-protein interactions. Mutations in TTC19 have recently been shown to cause mitochondrial complex III deficiency and neurological impairment in humans. The exact function of this protein is unknown.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse TTC19

Biochem./physiol. Wirkung

TTC19′s fucntion is not fully determined yet.

Sequenz

Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable