AV33727

Anti-NFE2L3 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-NRF3, Anti-Nuclear factor (erythroid-derived 2)-like 3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 76 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_004280
• UniProt-Hinterlegungsnummer: Q9Y4A8
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NFE2L3(9603)

Beschreibung

Allgemeine Beschreibung

Nuclear factor erythroid 2-related factor 3, NFE2L3, is a basic-region leucine zipper (bZIP) transcription factor. It is a glycoprotein expressed in the endoplasmic reticulum and the nuclear membrane.

Immunogen

Synthetic peptide directed towards the middle region of human NFE2L3

Biochem./physiol. Wirkung

NFE2L3 activates erythroid-specific, globin gene expression.

Sequenz

Synthetic peptide located within the following region: NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable