AV31464
Anti-OLIG2 (AB2) antibody produced in rabbit
affinity isolated antibody
Synonym(e):
Anti-BHLHB1, Anti-OLIGO2, Anti-Oligodendrocyte lineage transcription factor 2, Anti-PRKCBP2, Anti-RACK17
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(3)
About This Item
UNSPSC-Code:
12352203
NACRES:
NA.41
Empfohlene Produkte
Biologische Quelle
rabbit
Qualitätsniveau
Konjugat
unconjugated
Antikörperform
affinity isolated antibody
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Mol-Gew.
32 kDa
Speziesreaktivität
rat, human, mouse, dog, guinea pig, horse
Konzentration
0.5 mg - 1 mg/mL
Methode(n)
immunohistochemistry: suitable
western blot: suitable
NCBI-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
wet ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... OLIG2(10215)
Allgemeine Beschreibung
OLIG2 is a basic helix-loop-helix (bHLH) transcription factor that is expressed in the spinal cord. This transcription factor is involved in the development of oligodendrocytes and motor neurons. OLIG2 may be useful as a diagnostic marker of oligodendroglial cancer.
Rabbit Anti-OLIG2 (AB2) antibody recognizes chicken, human, mouse, rat, and bovine OLIG2.
Rabbit Anti-OLIG2 (AB2) antibody recognizes chicken, human, mouse, rat, and bovine OLIG2.
Immunogen
Synthetic peptide directed towards the N terminal region of human OLIG2
Anwendung
Rabbit Anti-OLIG2 (AB2) antibody is suitable for use in western blot applications at a concentration of 1μg/ml.
Biochem./physiol. Wirkung
OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Sequenz
Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Empfehlung
Produkt-Nr.
Beschreibung
Preisangaben
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Y Marie et al.
Lancet (London, England), 358(9278), 298-300 (2001-08-11)
OLIG2 is a recently identified transcription factor involved in the specification of cells in the oligodendroglial lineage. We investigated the expression of OLIG2 by in-situ hybridisation in 21 brain tumours: nine grade II and III oligodendrogliomas, three grade II oligoastrocytomas
Qiao Zhou et al.
Cell, 109(1), 61-73 (2002-04-17)
OLIG1 and OLIG2 are basic-helix-loop-helix (bHLH) transcription factors expressed in the pMN domain of the spinal cord, which sequentially generates motoneurons and oligodendrocytes. In Olig1/2 double-mutant mice, motoneurons are largely eliminated, and oligodendrocyte differentiation is abolished. Lineage tracing data suggest
Christian Gonzalez et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(33), 10924-10936 (2014-08-15)
Glioma growth is driven by signaling that ultimately regulates protein synthesis. Gliomas are also complex at the cellular level and involve multiple cell types, including transformed and reactive cells in the brain tumor microenvironment. The distinct functions of the various
Ginam Cho et al.
Developmental biology, 393(1), 137-148 (2014-06-27)
Mutations in the Aristaless related homeodomain transcription factor (ARX) are associated with a diverse set of X-linked mental retardation and epilepsy syndromes in humans. Although most studies have been focused on its function in the forebrain, ARX is also expressed
Benjamin Ettle et al.
Molecular and cellular neurosciences, 62, 68-78 (2014-07-16)
Myelin loss is a widespread neuropathological hallmark of the atypical parkinsonian disorder multiple system atrophy (MSA). On a cellular level, MSA is characterized by alpha-synuclein (aSyn)-positive glial cytoplasmic inclusions (GCIs) within mature oligodendrocytes leading to demyelination as well as axonal
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.