AV13104

Anti-TRHR antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Thyrotropin-releasing hormone receptor
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 45 kDa
• Speziesreaktivität: rat, rabbit, mouse, human, pig, dog
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_003292
• UniProt-Hinterlegungsnummer: Q01717
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TRHR(7201)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human TRHR

Anwendung

Anti-TRHR antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem./physiol. Wirkung

Thyrotropin-releasing hormone/thyrotropin-releasing factor (TRH, TRF) is a tripeptidal hormone that binds to Thyrotropin-releasing hormone receptor. It subsequently stimulates the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary.

Sequenz

Synthetic peptide located within the following region: ISCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSD

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable