AV100807

Anti-ETV6 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Ets variant gene 6 (TEL oncogene), Anti-TEL, Anti-TEL/ABL
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 53 kDa
• Speziesreaktivität: rabbit, rat, horse, dog, bovine, human, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001978
• UniProt-Hinterlegungsnummer: P41212
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... ETV6(2120)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal region of human ETV6

Anwendung

Anti-ETV6 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem./physiol. Wirkung

ETV6 belongs to the Ets family of transcription factors and is rearranged in human myeloid and lymphoid leukemias. ETV6 is required for the process of hematopoiesis within bone marrow.

Sequenz

Synthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable