AV09002

Anti-SerPINH1 antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 46 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunoprecipitation (IP): suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001226
• UniProt-Hinterlegungsnummer: P50454
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SERPINH1(871)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal region of human SERPINH1

Anwendung

Anti- SerPINH1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem./physiol. Wirkung

SerPINH1 (Hsp47) is a molecular chaperone that regulates protein folding of type I and type IV procollagen in the endoplasmic reticulum. The activity of Hsp47 is critical for the development of well-organized cartilage and formation of normal endochondral bone.

Sequenz

Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable