Direkt zum Inhalt
Merck

AMAB90791

Sigma-Aldrich

Monoclonal Anti-SLC22A2 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0628, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(e):

OCT2

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.43

Biologische Quelle

mouse

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

CL0628, monoclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunohistochemistry: 1:200- 1:500

Isotyp

IgG1

Ensembl | Human Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... SLC22A2(6582)

Allgemeine Beschreibung

Solute carrier family 22 member 2 (SLC22A2) also known as organic cation transporter 2 (OCT2), is expressed prominently in the basolateral membrane of epithelial cells of kidney, especially in the proximal renal tubule. SLC22A2 possess 12 transmembrane domains and is the integral plasma membrane protein. In the human, SLC22A2 gene is mapped to chromosome 6q26.

Immunogen

solute carrier family 22 (organic cation transporter), member 2, recombinant protein epitope signature tag (PrEST)

Sequence
ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR

Epitope
Binds to an epitope located within the peptide sequence KNAEAMRIIKHIAKK as determined by overlapping synthetic peptides.

Anwendung

Monoclonal Anti-SLC22A2 antibody produced in mouse has been used in immunostaining.

Biochem./physiol. Wirkung

Solute carrier family 22 member 2 (SLC22A2) is involved in the transport of cationic substances like drugs, toxins, waste metabolites like creatinine, neurotransmitters etc., from the kidney. Expression of SLC22A2 in kidney is regulated by methylation of the promoter region. The major substrate for SLC22A2 is metformin, an anti-diabetic agent. Lack of SLC22A2 leads possibly to drug toxicity as these substances are not eliminated from the body. Imipramine, clonidine, verapamil, quinidine, carvedilol, interact with SLC22A2 by hydrophobic interaction and leads to its inhibition.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86074

Physikalische Form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Deficiency in the organic cation transporters 1 and 2 (Oct1/Oct2 (Slc22a1/Slc22a2)) in mice abolishes renal secretion of organic cations
Jonker JW, et al.
Molecular and Cellular Biology, 23(21), 7902-7908 (2003)
SLC22A2 is associated with tubular creatinine secretion and bias of estimated GFR in renal transplantation
Reznichenko A, et al.
Physiological Genomics, 45(6), 201-209 (2013)
Kidney-specific expression of human organic cation transporter 2 (OCT2/SLC22A2) is regulated by DNA methylation
Aoki M, et al.
American Journal of Physiology: Renal Physiology, 295(1), F165-F170 (2008)
The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26
Koehler MR, et al.
Cytogenetic and genome research, 79(3-4), 198-200 (1997)
Response to Comment on ?Epigenetic activation of the drug transporter OCT2 sensitizes renal cell carcinoma to oxaliplatin?
Zheng X, et al.
Science Translational Medicine, 9(391), eaam6298-eaam6298 (2017)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.