WH0010841M1

Monoclonal Anti-FTCD antibody produced in mouse

clone 3A4, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-LCHC1, Anti-formiminotransferase cyclodeaminase
• Numéro MDL: MFCD00164605
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 3A4, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: NM_206965
• Numéro d'accès UniProt: O95954
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FTCD(10841)

Description

Description générale

FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.(supplied by OMIM) Formimidoyltransferase cyclodeaminase (FTCD) gene is localized in human fetal and adult liver. The gene is located on human chromosome 21q22.3.

Immunogène

FTCD (NP_996848, 440 a.a. ~ 541 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Application

Monoclonal Anti-FTCD antibody produced in mouse has been used in indirect immunofluorescence staining, immunohistochemistry and immunocytochemistry.

Actions biochimiques/physiologiques

Formimidoyltransferase cyclodeaminase (FTCD) deficiency is associated with formiminoglutamic aciduria. FTCD is considered as a therapeutic target for hepatocellular carcinoma (HCC). Mutations in FTCD is linked to glutamate formiminotransferase deficiency.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)